PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015900772.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family MYB_related
Protein Properties Length: 567aa    MW: 64350.8 Da    PI: 7.3399
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015900772.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.41.4e-12112152445
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      W ++E+ ll+++++++G g+W+ +a+++g +++  qc+++++
   XP_015900772.1 112 WNADEESLLLEGIEMYGYGNWSEVAEHVG-TKSKAQCIDHYN 152
                      *****************************.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0250244.9E-15740567IPR016827Transcriptional adaptor 2
SMARTSM002913.1E-104893IPR000433Zinc finger, ZZ-type
PfamPF005692.4E-95284IPR000433Zinc finger, ZZ-type
CDDcd023351.26E-2452100No hitNo description
PROSITE profilePS5013510.6445295IPR000433Zinc finger, ZZ-type
SuperFamilySSF578506.95E-1552115No hitNo description
PROSITE patternPS0135705481IPR000433Zinc finger, ZZ-type
SuperFamilySSF466891.2E-12107158IPR009057Homeodomain-like
PROSITE profilePS5129321.579107159IPR017884SANT domain
SMARTSM007171.1E-10108157IPR001005SANT/Myb domain
PfamPF002492.9E-12111152IPR001005SANT/Myb domain
CDDcd001671.59E-11112152No hitNo description
Gene3DG3DSA:1.10.10.601.9E-9112154IPR009057Homeodomain-like
SuperFamilySSF466896.45E-20474563IPR009057Homeodomain-like
PROSITE profilePS509349.847480567IPR007526SWIRM domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0009409Biological Processresponse to cold
GO:0016573Biological Processhistone acetylation
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 567 aa     Download sequence    Send to blast
MGRSRAVSRA ADDDPNQRSK RKRPASGAEP IEITSYNTVL GQGNSEPKGA LYHCNYCNKD  60
ISGKIRIKCV ICPNFDLCIE CFSVGAEVTP HNSKHPYRVM DNLAFPLICP DWNADEESLL  120
LEGIEMYGYG NWSEVAEHVG TKSKAQCIDH YNAIYMNSPF FPLPDLSHVM GKTREELLTM  180
AKEIKKAEAP MLGEVPVEEE SLRYNESKKG PIPQSSARST SEVGTGPVFG AVKKTSNRTQ  240
INHEAKAEES QVETQVDRSI GEKKPRSLGD ERPSMMELSG YNFKRQEFEI EYDNDAEQLL  300
ADMDFKDSDT SAERELKLRV LHIYSKRLDE RKRRKDFILE RNLLYPDPIE KNLSPEEKEI  360
YQRYKVFMRF HSKKEHEEFI KNIIEEHRIV KRIQDLQQAR AAGCRTANEA NRFIEQKRKR  420
ETEESALRIK ESSQAGPSGK GLQKPNHVKG EADCNSPRGL ARGSTSLHLG GKESTLTTQP  480
IIASSLDNWD ISGLRGSELI SDTEKQLCNE IRILPSHYLN MLQIISTEMW KGNVTKKSDA  540
YSLFKVEPSK VDKVYDMVMK KGITTSS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1330335RKRRKD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015900772.10.0PREDICTED: transcriptional adapter ADA2-like isoform X1
SwissprotQ75LL60.0TADA2_ORYSJ; Transcriptional adapter ADA2
TrEMBLW9RN140.0W9RN14_9R
STRINGGLYMA13G11200.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15371726